SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038881 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038881
Domain Number 1 Region: 193-256
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000229
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 522-589,625-714
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000422
Family SPRY domain 0.024
Further Details:      
 
Domain Number 3 Region: 402-506
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000755
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 4 Region: 3-51
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000379
Family RING finger domain, C3HC4 0.035
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038881
Domain Number - Region: 243-318
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0432
Family Apolipoprotein A-I 0.019
Further Details:      
 
Domain Number - Region: 135-177
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0518
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038881   Gene: ENSMMUG00000012182   Transcript: ENSMMUT00000045837
Sequence length 736
Comment pep:known chromosome:MMUL_1:1:133726390:133732432:1 gene:ENSMMUG00000012182 transcript:ENSMMUT00000045837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREVLGQQGYIGHGGDPSSEPTSPAST
PSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGALHPQVIMFPCPACQGDVELGERG
LAGLFRNLTLERVVERYRQSVSVGGAILCQLCKPPPLEATKGCTECRATFCNECFKLFHP
WGTQKAQHEPTLPTLSFRPKGLMCPDHKEEVTHYCKTCQRLVCQLCRVRRTHSGHKITPV
LSAYQALKDKLTKSLTYILGNQDTVQTQICELEEAVRHTEVSGQQAKEEVSQLVRGLGAV
LEEKRASLLQAIEECQQERLARLSAQIQEHRSLLDGSGLVGYAQEVLKETDQPCFVQAAK
QLHNRIARATEALQTFRPAASSSFRHCQLDVGREMKLLTELNFLRVPEAPVIDTQRTFAY
DQIFLCWRLPPHSPPAWHYTVEFRRTDVPAQPGPTRWQRREEVRGTSALLENPDTGSVYV
LRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDGRWGASRERLAISKDQRAVRSVPGLPL
LLAADRLLTGCHLSVDVVLGDVAVTQGRSYWACAVDPASYLVKVGVGLESKLQESFQGAP
DVISPRYDPDSGHDSGAEDATVEASPPFAFLTIGMGKILLGSGASSNAGLTGRDGPAAGC
TVPLPPRLGICLDYERGRVSFLDAVSFRGLLECPLDCSGPVCPAFCFIGGGAVQLQEPVG
TKPERKVTIGGFAKLD
Download sequence
Identical sequences A0A2K5K275 A0A2K5LT35 A0A2K5TMA5 A0A2K6A327
ENSMMUP00000038878 ENSMMUP00000038879 XP_011768007.1.29376 XP_011783661.1.43180 XP_011842899.1.47321 XP_011932197.1.92194 ENSMMUP00000038881 9544.ENSMMUP00000038879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]