SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039410 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039410
Domain Number 1 Region: 2-172
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-54
Family SPRY domain 0.0000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039410   Gene: ENSMMUG00000031833   Transcript: ENSMMUT00000046368
Sequence length 172
Comment pep:known scaffold:MMUL_1:1099214113513:1261:1806:-1 gene:ENSMMUG00000031833 transcript:ENSMMUT00000046368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLRLCAVDVTLDAASAHPSLEVSEDGKSVSSDPQRFSEQTCALSLERFSAGRHYWEVHVG
RRSRWFLGACLAAVPRAGPVRLSPATGYWVLGLWNGCEYFVLAPHRVALPLRVPPRRLGV
FLDCEAGQLSFFNVSDGSHIFTFHDTFSGALCAYFRPRAHDGGERPDPLTIC
Download sequence
Identical sequences ENSMMUP00000039410 ENSMMUP00000039410 9544.ENSMMUP00000039410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]