SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040121 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040121
Domain Number 1 Region: 18-118,174-422
Classification Level Classification E-value
Superfamily MFS general substrate transporter 9.68e-34
Family LacY-like proton/sugar symporter 0.037
Further Details:      
 
Domain Number 2 Region: 457-506
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000291
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040121
Domain Number - Region: 549-658,687-711
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00157
Family Glycerol-3-phosphate transporter 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040121   Gene: ENSMMUG00000020443   Transcript: ENSMMUT00000047095
Sequence length 763
Comment pep:known chromosome:MMUL_1:11:21214248:21455253:1 gene:ENSMMUG00000020443 transcript:ENSMMUT00000047095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIARALGGIIMKMSITQIERRFD
ISSSLAGLIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLIMGTGSILTALPHFFMGY
YRYSKETHINPSENSTSSLSTCLINQILSFNRTSPEIVEKDCVKESGSHMWMYVFMGNML
RGIGETPIGPLGISYIDDFAKEGHSSLYVGSLNAIGMIGPVIGFILGSLFAKMYVDIGYV
DLSTIRITPKDSRWVGAWWLGFLVSGLFSITSSIPFFFLPQNPNKPQKERKVSLSLHVLK
TNDERSQTANLTNRGKKVTKNVTGFFQSLKSLLTNPLYVMFVLLTLLQISSFIGSFTYIF
KYMEQQYGQSASQANFLLGVITIPTIATGMFLGGYIIKKFKLSLVGIAKFSLLTSIISFL
FQLIYFPLICESKSVAGLTLTYDGNNSVASHIDVPLSYCNSECNCDESQWEPVCGNNGIT
YLSPCLAGCKSLSGIKKSTVFYNCSCVEVTGLQNRNYSAHLGECPRDDACTRKFYIYVAI
QVINSWFSATGGTVCILLIVNTISSLYIYLLLCQKSVCCRYVTLFLASLFCSIDLSFYIW
MSRSVVSQGSSVRFFNSFFYSLIVQPELKALAMGFHSMVIRTLGGILAPIYFGALIDKTC
MKWSTTSCGARGACRIYNSVFLGRVYLGLSTALRFSALVLYIVFIFVMKKKFQGKDTKAS
DNERKVMDEANLEFLNNGEHFVPSAGADSKTCNLDMQDNAAAN
Download sequence
Identical sequences ENSMMUP00000009548 9544.ENSMMUP00000009548 ENSMMUP00000040121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]