SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040204 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040204
Domain Number 1 Region: 25-212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.53e-44
Family Calnexin/calreticulin 0.00088
Further Details:      
 
Domain Number 2 Region: 197-305
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 4.19e-35
Family P-domain of calnexin/calreticulin 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040204   Gene: ENSMMUG00000032134   Transcript: ENSMMUT00000047178
Sequence length 313
Comment pep:known chromosome:MMUL_1:1:54387192:54399688:-1 gene:ENSMMUG00000032134 transcript:ENSMMUT00000047178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAKQIYQHLLETTISCLSTIHSDGGFQHEWKKRWVQSKHQPDYGKFQLTAGKFYGDKEKD
KGLQTSEDAKFYALSTRLKPFSNENETLVVLFSVKHEQSIDCGGGYVKLFPATTRIVFTK
HKGPQAVFRPDICDFGNNILFCHPSLPRVNVCWSSAKGCEINKDTHLYTLIIRFNATYEV
KIDNQQVAAGNLKEDWDFLPPRKIKDPYAWKPRKWDECLHIEDPEDKKPEDWEDFEYILD
PEAKKLDDWNEAMDGEWERPLIPNPKYKGKWKPRIIGNPNYQGEIDNPKYKPDATIRHYY
NISVLSLDLWQVK
Download sequence
Identical sequences ENSMMUP00000040204 9544.ENSMMUP00000040204 ENSMMUP00000040204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]