SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040391 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040391
Domain Number 1 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 72-132
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.11e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 269-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-19
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 6 Region: 461-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040391
Domain Number - Region: 3-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00343
Family SCAN domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040391   Gene: ENSMMUG00000016199   Transcript: ENSMMUT00000047362
Sequence length 526
Comment pep:known chromosome:MMUL_1:1:43361470:43380377:1 gene:ENSMMUG00000016199 transcript:ENSMMUT00000047362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQQLLITLPTKASTWVKLQHPKKATEGVPLWEDVTKMFEGKALLSQDADDLKTQRESVE
DEVTPGLPTAESHELLTFKDISVDFTQEEWGQLAPAYQNLYREVMLENYSNLVSVGYQLS
KPSVISQLEKGEEPWMAEKEGPGDPSSDLKSKMETIESSAKSAISQERLYHGIMMERFMR
DDIIYSTLRKASTYDDVLERHQETCVRDVRQAILTHKKRVQETNKFGENIIMRSNVVIEQ
RHHKYDTPTKRNTYKLDLINHPTSYIRTKTYECNICEKIFKQPIHLTEHMRIHTGEKPFR
CKECGRAFSQSASLSTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPYVCDKC
QKAFSQNISLVQHLRTHSGEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYACTACCKTF
SHRAYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDS
SFKKHQRHHTGEKPYECNECGKAFSYNSSLSRHHEIHRRNAFRNNV
Download sequence
Identical sequences A0A2K6CRA9 F7FR26 G7NUD6
XP_011761958.1.29376 XP_014991996.1.72884 ENSMMUP00000040391 9544.ENSMMUP00000040391 ENSMMUP00000040391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]