SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040999 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040999
Domain Number 1 Region: 658-845
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.46e-59
Family Nucleotide and nucleoside kinases 0.000000153
Further Details:      
 
Domain Number 2 Region: 392-491
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-33
Family PDZ domain 0.0000283
Further Details:      
 
Domain Number 3 Region: 494-608,651-685
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-31
Family SH3-domain 0.0000956
Further Details:      
 
Domain Number 4 Region: 239-334
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-27
Family PDZ domain 0.0000226
Further Details:      
 
Domain Number 5 Region: 133-238
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-27
Family PDZ domain 0.0000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040999   Gene: ENSMMUG00000013948   Transcript: ENSMMUT00000047962
Sequence length 849
Comment pep:known chromosome:MMUL_1:X:69425963:69472986:1 gene:ENSMMUG00000013948 transcript:ENSMMUT00000047962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLP
SQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQA
SPALLLVNPEALKPSLSVNGSDGMFKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFI
TKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLVVRRRQPPPE
TIMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVN
NTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNS
SLGYLGAVESKVSYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHKGSTGLGFNIVG
GEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQSVTIV
AQYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPS
QGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHA
RTGMIESNRDFPGLSDDYYGAKNLKGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYAR
PVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQD
NKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSI
EALMEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHY
IWVPSPEKL
Download sequence
Identical sequences A0A2I3MJE9 A0A2K5IPH2 A0A2K5LJ59 A0A2K5WWB9 A0A2K5YRJ4 A0A2K6BME3 F6SE42
XP_005593926.1.63531 XP_007990184.1.81039 XP_011731086.1.29376 XP_011916200.1.92194 XP_014983112.1.72884 ENSMMUP00000040999 9544.ENSMMUP00000018335 ENSMMUP00000018335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]