SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94152571|ref|YP_581978.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94152571|ref|YP_581978.1|
Domain Number 1 Region: 91-235
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.97e-30
Family DsbC/DsbG C-terminal domain-like 0.0024
Further Details:      
 
Domain Number 2 Region: 29-82
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.000000000000432
Family DsbC/DsbG N-terminal domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94152571|ref|YP_581978.1|
Sequence length 238
Comment thiol-disulfide isomerase [Cupriavidus metallidurans CH34]
Sequence
MKKIAAALAFAAMSIAAHASPETDSVMATLKIKYPNTNFTSVEATPIPGIYELTMGKNIA
YTDKEGHYFLFGSMYDMEKRQDLTASKREAANKIDVSKLPIQDAIVRVKGKGTRKLYLFS
DPDCPYCKQLEAQAFPQLDDVTIYTFMFPLDSLHPQASAKSESIWCLPAAQRAAAWDKLV
TQNVPAPAAKCDNPIKRIAALGDGLGVRGTPTLFSADGRILPGAADAARIDAWLNGAK
Download sequence
Identical sequences Q58AH8
gi|94152571|ref|YP_581978.1| 266264.Rmet_6169 WP_011229372.1.12480 gi|56130737|ref|YP_145640.1|NC_006466 gi|94152571|ref|YP_581978.1|NC_007971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]