SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94309179|ref|YP_582389.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94309179|ref|YP_582389.1|
Domain Number 1 Region: 36-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000989
Family PDI-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94309179|ref|YP_582389.1|
Sequence length 165
Comment hypothetical protein Rmet_0234 [Cupriavidus metallidurans CH34]
Sequence
MTPRSPLLRTVLHGLAALLLLVGPAVSMAASHLPPVTDIAAQSADAAKQGGPLVVLVSLP
GCTYCETARRNYLAPQAAAGEITARELDMTADTPLRDADGTMTTAKQWARAHNITVAPTV
LFLDRNGRNLASPLRGLQPDFYGAYLEQAVDTARAKLTEGLAASK
Download sequence
Identical sequences Q1LRV6
266264.Rmet_0234 gi|94309179|ref|YP_582389.1| WP_011515133.1.12480 WP_011515133.1.25839 WP_011515133.1.52493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]