SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94309499|ref|YP_582709.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94309499|ref|YP_582709.1|
Domain Number 1 Region: 97-337
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 5.1e-85
Family Nqo1 FMN-binding domain-like 0.000000721
Further Details:      
 
Domain Number 2 Region: 423-508
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 5.75e-28
Family Nqo1C-terminal domain-like 0.002
Further Details:      
 
Domain Number 3 Region: 340-421
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 1.29e-19
Family Nqo1 middle domain-like 0.00087
Further Details:      
 
Domain Number 4 Region: 3-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000671
Family Thioredoxin-like 2Fe-2S ferredoxin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94309499|ref|YP_582709.1|
Sequence length 518
Comment NAD-dependent formate dehydrogenase subunit beta [Cupriavidus metallidurans CH34]
Sequence
MSTTIFVPRDSTALALGADEVAQAIAREAEKRGADVRIVRNGSRGMFWLEPLVEVQTDAG
RVAYGPVTEDDVSALFDAGFLHGGSHALSHGATAEIPFLKKQERLTFMRVGITDPLSLDD
YIAHEGFVGLTRALSMAPAEIVQEVVDSGLRGRGGAAFPTGIKWKTVLGARSDVKYVVCN
ADEGDSGTFSDRMVMEDDPFMLIEGMVIAGLAVGAEQGYIYTRSEYPHAIAATEAAIEIA
TRAGWLGDDIRGSGRCFQLEVRKGAGAYVCGEETALLESLEGKRGVVRAKPPLPALEGLF
GKPTVINNVISLATVPVILARGAKFYQDFGMGRSRGTLPFQLAGNIRQGGLVEKAFGVTL
RELMLDYGGGTRSGRAIRAVQVGGPLGAYLPESRFDTPIDYEAYAAFGAVVGHGGIVVFD
ETVDMAKMARYAMEFCAIESCGKCTPCRIGSTRGVEVMDRIIAGDQPVKHVALVRDLCDT
MVNGSLCAMGSMTPYPVLSALDEFPEDFGLSGKAAKAA
Download sequence
Identical sequences Q1LQY6
266264.Rmet_0554 gi|94309499|ref|YP_582709.1| WP_011515416.1.12480 WP_011515416.1.25839 WP_011515416.1.52493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]