SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94310907|ref|YP_584117.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94310907|ref|YP_584117.1|
Domain Number 1 Region: 4-153
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.07e-49
Family Glutathione peroxidase-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94310907|ref|YP_584117.1|
Sequence length 153
Comment thiol peroxidase, thioredoxin-dependent [Cupriavidus metallidurans CH34]
Sequence
MTVSLNKAIPDFQAPATGGDFRLADQRGKTTVLYFYPKDNTPGCTTEAMNFRDQYDDFEK
AGAAVYGISRDSMKSHENFKAKLELPFELISDADEAICQLFDVIKMKKMYGKDVRGIERS
TFILDAKGVLRHEMRGIKVPNHVDEVLEIVKGM
Download sequence
Identical sequences A0A132HLZ7 Q1LLX8
WP_011516693.1.12480 WP_011516693.1.25839 WP_011516693.1.481 WP_011516693.1.52493 WP_011516693.1.66126 gi|94310907|ref|YP_584117.1| 266264.Rmet_1969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]