SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94311332|ref|YP_584542.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94311332|ref|YP_584542.1|
Domain Number 1 Region: 96-254
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.2e-31
Family DsbC/DsbG C-terminal domain-like 0.0000851
Further Details:      
 
Domain Number 2 Region: 30-87
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.0000000000282
Family DsbC/DsbG N-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94311332|ref|YP_584542.1|
Sequence length 257
Comment disulfide isomerase/thiol-disulfide oxidase [Cupriavidus metallidurans CH34]
Sequence
MFAQRSHISFLLAASFMVVTGCSKAETADKPAVLKALEGQGLTVTQEFKVGGGLRAFAAV
AGDRPIAVYITSDGNAIVGTRLNAKGEPMDEADLEKLAAKPVSDKEWSQLQSSTWVLDGK
ADAPRVIYTFSDANCPYCNAFWEAARPWVDSGKVQLRHILVGIIKDDSPAKAAAILGAPD
RSAALLTNERQFGQGGITPAKSVPADVRKILDDNLALMASTGFRGTPGIVVRGPNGILKK
YNGMPRGAQLGEVLGPR
Download sequence
Identical sequences A0A086BSX0 A0A1G7UH05 A0A1V2XRX9 A0A2E9RYY3 Q1LKQ3 Q8GQA2
WP_003149839.1.100899 WP_003149839.1.11058 WP_003149839.1.11178 WP_003149839.1.1187 WP_003149839.1.12400 WP_003149839.1.12480 WP_003149839.1.12497 WP_003149839.1.13092 WP_003149839.1.14096 WP_003149839.1.15789 WP_003149839.1.19260 WP_003149839.1.22782 WP_003149839.1.23231 WP_003149839.1.24442 WP_003149839.1.25444 WP_003149839.1.25839 WP_003149839.1.29003 WP_003149839.1.30810 WP_003149839.1.31271 WP_003149839.1.34731 WP_003149839.1.35599 WP_003149839.1.37542 WP_003149839.1.38510 WP_003149839.1.40482 WP_003149839.1.42634 WP_003149839.1.43022 WP_003149839.1.43317 WP_003149839.1.445 WP_003149839.1.45298 WP_003149839.1.47314 WP_003149839.1.48990 WP_003149839.1.52578 WP_003149839.1.54239 WP_003149839.1.57841 WP_003149839.1.57966 WP_003149839.1.58417 WP_003149839.1.5850 WP_003149839.1.60396 WP_003149839.1.61294 WP_003149839.1.62035 WP_003149839.1.63423 WP_003149839.1.63697 WP_003149839.1.63989 WP_003149839.1.64825 WP_003149839.1.65247 WP_003149839.1.66286 WP_003149839.1.67948 WP_003149839.1.68800 WP_003149839.1.7038 WP_003149839.1.71570 WP_003149839.1.71738 WP_003149839.1.72772 WP_003149839.1.7448 WP_003149839.1.783 WP_003149839.1.78542 WP_003149839.1.79921 WP_003149839.1.81368 WP_003149839.1.8203 WP_003149839.1.82703 WP_003149839.1.83617 WP_003149839.1.85815 WP_003149839.1.87716 WP_003149839.1.89494 WP_003149839.1.89848 WP_003149839.1.89939 WP_003149839.1.9034 WP_003149839.1.91527 WP_003149839.1.92321 WP_003149839.1.93250 WP_003149839.1.94230 WP_003149839.1.94896 WP_003149839.1.96852 WP_003149839.1.96967 WP_003149839.1.9698 WP_003149839.1.98111 WP_003149839.1.98814 WP_003149839.1.98819 WP_003149839.1.99341 266264.Rmet_2396 gi|94311332|ref|YP_584542.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]