SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94311572|ref|YP_584782.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94311572|ref|YP_584782.1|
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.08e-34
Family Thioltransferase 0.0025
Further Details:      
 
Domain Number 2 Region: 111-148,202-245
Classification Level Classification E-value
Superfamily TPR-like 0.00000237
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94311572|ref|YP_584782.1|
Sequence length 280
Comment thioredoxin domain-containing protein [Cupriavidus metallidurans CH34]
Sequence
MSDVTLQNFEADVIEMSRQVPVLVDFWAPWCGPCRTLGPMLEKLEAESGGKWRLAKVNVD
ENQELAAHFGVRSIPHVVAFADGQAVDQFIGVLPESQLREFLDRLTPNPGELALREAVEL
AAAGDREAAQASFQAALAYDPGADTARLTYIGFLLDGNKIADAETEFGLLSPRAAQEDAY
AALQTRLEAMKGVGDLPDGADLKARVAANPADLPARLDLAHVLIARREYEAALEQLLEIV
RSDRWFEDDVGRKTMLSVFELMGDDPAVSRWRRQLATVLN
Download sequence
Identical sequences Q1LK13
WP_011517212.1.12480 WP_011517212.1.25839 gi|94311572|ref|YP_584782.1| 266264.Rmet_2636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]