SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94311632|ref|YP_584842.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94311632|ref|YP_584842.1|
Domain Number 1 Region: 85-205
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.55e-21
Family Glutathione S-transferase (GST), C-terminal domain 0.0087
Further Details:      
 
Domain Number 2 Region: 6-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.18e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94311632|ref|YP_584842.1|
Sequence length 218
Comment glutathione S-transferase [Cupriavidus metallidurans CH34]
Sequence
MSKTTLTISSKTYSSWSLRGWLLARFAGLEFEEVLVPPDDPAARAEILLLSPSILVPCLR
HEGVTVWDTMAIAEYLNEIRPKAKLLPDDLVARAHCRAICGEMHSGFAAMRAALPMNLKG
HFPGLKVWSRAQADIDRITAIWAECLQRYGGPYLFGKRRTIADAMYAPVVTRFITYGVKL
DAPLVEFCKTILAMPEMQEWIHAAREEPDEISELDVEF
Download sequence
Identical sequences L2EM75 Q1LJV3
gi|94311632|ref|YP_584842.1| WP_008642239.1.12480 WP_008642239.1.22474 WP_008642239.1.25839 WP_008642239.1.38154 WP_008642239.1.63697 WP_008642239.1.64716 266264.Rmet_2700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]