SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94312053|ref|YP_585263.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94312053|ref|YP_585263.1|
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.3e-34
Family Glutathione peroxidase-like 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94312053|ref|YP_585263.1|
Sequence length 168
Comment Peroxiredoxin [Cupriavidus metallidurans CH34]
Sequence
MIAIGQRVPDATLYEFFETESEGCVLGPNAFSVAELVKGRKIVVFGLPGAFTPTCSAKHV
PSYLKEYDALRAAGVDEIWCHSVNDAFVMGAWGREQKATGKVRMMGDGAAQWARALGLDQ
DLSQRGLGVRAKRYAMVVDDGVVTHLFIEEPGEFKVSSAEWVLQALRA
Download sequence
Identical sequences A0A132H9A8 Q1LIN2
gi|94312053|ref|YP_585263.1| 266264.Rmet_3122 WP_011517616.1.12480 WP_011517616.1.25839 WP_011517616.1.481 WP_011517616.1.52493 WP_011517616.1.66126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]