SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94313058|ref|YP_586267.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94313058|ref|YP_586267.1|
Domain Number 1 Region: 3-215
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.07e-71
Family Glutathione peroxidase-like 0.00000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94313058|ref|YP_586267.1|
Sequence length 217
Comment 1-Cysteine peroxiredoxin [Cupriavidus metallidurans CH34]
Sequence
MAIRLGEEAPDFTADTTEGKIHFHEWIGDSWAILFSHPKDFTPVCTTELGYMAKLKPEFD
KRNTKIIGLSIDPVGDHSRWVKDIEETQGATVNYPMIGDHDLKVAKLYDMIHPEASGGPR
TAADNATIRAVFMIGPDKKVKAMLVYPMSAGRNFDEVLRLLDSLQLNAKHTVATPVNWKP
GDDVIIPTSVSDDDAKKKYPQGFKTLKPYLRTVAQPK
Download sequence
Identical sequences A0A132HSS5 L2EBP2 Q1LFS8
gi|94313058|ref|YP_586267.1| 266264.Rmet_4131 WP_008650897.1.12480 WP_008650897.1.22474 WP_008650897.1.25839 WP_008650897.1.38154 WP_008650897.1.481 WP_008650897.1.52493 WP_008650897.1.63697 WP_008650897.1.64716 WP_008650897.1.66126 gi|94313058|ref|YP_586267.1|NC_007974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]