SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94313845|ref|YP_587054.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94313845|ref|YP_587054.1|
Domain Number 1 Region: 23-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.33e-19
Family PDI-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94313845|ref|YP_587054.1|
Sequence length 108
Comment thiol-disulfide isomerase/thioredoxin [Cupriavidus metallidurans CH34]
Sequence
MSMTRSFAATEPTRDEIDALPGATLLEFGAPWCGYCMRAQPLIEEAFGGYPAIHHVKVED
GSGRPLGRSFRVKLWPTLVFLRDGREVARLVRPESAKDIAAAMRRILP
Download sequence
Identical sequences Q1LDJ1
gi|94313845|ref|YP_587054.1| gi|94313845|ref|YP_587054.1|NC_007974 266264.Rmet_4923 WP_011519346.1.12480 WP_011519346.1.25839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]