SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94309054|ref|YP_582264.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94309054|ref|YP_582264.1|
Domain Number 1 Region: 4-201
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.46e-42
Family DsbA-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94309054|ref|YP_582264.1|
Sequence length 219
Comment 2-hydroxychromene-2-carboxylate isomerase [Cupriavidus metallidurans CH34]
Sequence
MTAPIDFYFDFSSPYGYFASTRIDDIAQKYGRYVIWHPILLGVVFKTTGSSPLPSIPLKG
DYCWRDFERTSEFNHIDYKRPTHFPLPTRHAARAMLWLQNNHGADVATAFAKAVYRALFV
DDINIAEPAELAKLAEPLGVDPIAMNEGANNYQIKDQLKAEIDVAMAKGVFGSPFVIVDG
EPFWGFDRFDQVEAYLKSRRQTELRAVGGNELNKEKKPA
Download sequence
Identical sequences A0A132HBZ0 Q1LS81
WP_011515029.1.12480 WP_011515029.1.25839 WP_011515029.1.481 WP_011515029.1.66126 266264.Rmet_0109 gi|94309054|ref|YP_582264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]