SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94309123|ref|YP_582333.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94309123|ref|YP_582333.1|
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.35e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0036
Further Details:      
 
Domain Number 2 Region: 81-200
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.7e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94309123|ref|YP_582333.1|
Sequence length 229
Comment glutathione S-transferase [Cupriavidus metallidurans CH34]
Sequence
MKLVIGNKNYSSWSLRPWLLLRHAGIAFEEIAVRLFTKEFAAEIARYSPAGKVPALIDGD
VTVWDSLSISEYVAERFPEKALWPKDAAARALARSICAEMHSGFGNLRSQMPMNVTAMLP
GLGWNVAVQRDIDRIASIWTDLRTRYASEGPFLFGSFTIADAFYAPIVSRFATYGVHLPE
SAKAYADFVLALPAMQEWAAAAREERDFVPADEPYRTEPDRPDAIIVSG
Download sequence
Identical sequences Q1LS12
gi|94309123|ref|YP_582333.1| WP_011515087.1.12480 WP_011515087.1.25839 WP_011515087.1.52493 266264.Rmet_0178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]