SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94309178|ref|YP_582388.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94309178|ref|YP_582388.1|
Domain Number 1 Region: 38-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.23e-39
Family Glutathione peroxidase-like 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94309178|ref|YP_582388.1|
Sequence length 179
Comment Thiol-disulfide isomerase-like and thioredoxin-like protein [Cupriavidus metallidurans CH34]
Sequence
MSNSATPATPSSKKRWPIAVAVVIVALLGFFGYRAMTPANTVPDATFTLLSGEKLSTGDL
KGKVYLINFWATSCATCVKEMPQMVSTYKQFKDKGLDFVAVAMNYDPPMYVMNYAKTREL
PFKVAMDADGAAAKAFGNVQLTPTTFVVDKNGKILKRYVGEPEWDALHKLLDGALANAA
Download sequence
Identical sequences L2E6W1 Q1LRV7
266264.Rmet_0233 gi|94309178|ref|YP_582388.1| WP_008652614.1.12480 WP_008652614.1.22474 WP_008652614.1.25839 WP_008652614.1.38154 WP_008652614.1.52493 WP_008652614.1.63697 WP_008652614.1.64716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]