SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94309197|ref|YP_582407.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94309197|ref|YP_582407.1|
Domain Number 1 Region: 3-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.22e-23
Family Thioltransferase 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94309197|ref|YP_582407.1|
Sequence length 85
Comment glutaredoxin 3 [Cupriavidus metallidurans CH34]
Sequence
MARVVMYSTVVCPYCQMAERLLKQRGVEAIEKILIDREPGKREEMMTRTGRRTVPQIYID
ETHVGGFDDLSALDRQGGLVPLLAA
Download sequence
Identical sequences Q1LRT8
266264.Rmet_0252 WP_011515148.1.12480 WP_011515148.1.25839 gi|94309197|ref|YP_582407.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]