SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94310363|ref|YP_583573.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94310363|ref|YP_583573.1|
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.05e-32
Family ArsC-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94310363|ref|YP_583573.1|
Sequence length 115
Comment putative arsenate reductase or-like protein (glutaredoxin family) [Cupriavidus metallidurans CH34]
Sequence
MTTLLYGIPNCDTVKRARTWLESNGVDYTFHDFKKQGVDEKMLRAWLKHVPLTTLLNKKG
TTYRALSDADKTRAESEAGAIALMQTSPSLIKRPVLDRDGKVSVGFSADGYAALF
Download sequence
Identical sequences A0A132HM53 L2ED29 Q1LNH2
WP_008649082.1.12480 WP_008649082.1.25839 WP_008649082.1.481 WP_008649082.1.63697 WP_008649082.1.64716 WP_008649082.1.66126 266264.Rmet_1421 gi|94310363|ref|YP_583573.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]