SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94310785|ref|YP_583995.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94310785|ref|YP_583995.1|
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.17e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 150-218
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000027
Family Glutathione S-transferase (GST), C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94310785|ref|YP_583995.1|
Sequence length 310
Comment glutathione S-transferase [Cupriavidus metallidurans CH34]
Sequence
MPDIILHQYATSPFSEKIRLLLGAKDLSWCAVEIPPILPKPDLVALTGGYRRTPVMQIGA
DIYCDTALICEVLDRMAPLPPLYPPDQAAASSVMAAWFDSALFTASVTYTMQPAGVQAML
AHLTPDQIKAFVADRKAMRGDTNALRMPLPEADAMLHETFERLQEQFAAGVLHVAGPMLS
VADFSLYHNIWFIRRATALAAILDAYPLVKEWYARMQAYGHGKVRVIPAEDALAEALHND
PLAHDTTIQPDSGFAAGDAVTVTPTDYAKDPVAGVLMTLSADVVTIRRQDPRAGAVNVHF
PRQHYQVQAA
Download sequence
Identical sequences Q1LMA0
WP_011516576.1.12480 WP_011516576.1.25839 266264.Rmet_1847 gi|94310785|ref|YP_583995.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]