SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94310855|ref|YP_584065.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94310855|ref|YP_584065.1|
Domain Number 1 Region: 3-211
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.64e-40
Family DsbA-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94310855|ref|YP_584065.1|
Sequence length 217
Comment DSBA oxidoreductase [Cupriavidus metallidurans CH34]
Sequence
MTPIDIIITYDFICPWCWIGHQSLKAGIEQAGMAGRFRSQYQPYELNPDMPKPSSNRKAY
RSRKFGSWERSQVLDAEVAAAGKRVGLAFNYDRILVTPNTRLAHRLMRYVLDQDAARADD
LFSAVMEAYFTRGQDIGSLDVLVDIAVSIGFDAAGVREYLNGSAGETSVVAQELQAQFDG
VRSVPTYRVGNQRITDGQPPQHFARVLQAAAGEVENM
Download sequence
Identical sequences Q1LM30
WP_011516649.1.12480 WP_011516649.1.25839 gi|94310855|ref|YP_584065.1| 266264.Rmet_1917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]