SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94311327|ref|YP_584537.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94311327|ref|YP_584537.1|
Domain Number 1 Region: 5-165
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.76e-34
Family Glutathione peroxidase-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94311327|ref|YP_584537.1|
Sequence length 174
Comment periplasmic thioredoxin of cytochrome c-type biogenesis [Cupriavidus metallidurans CH34]
Sequence
MNRFLWPLLGFLVLVSFLAVGLTLKPSEVPSPLINKPAPRFSLPQLQAPDLTFSSESMIG
KVWVLNVWASWCAPCLEEHPVITELASRHAVSVVGMNYKDTPQNAIAWLRRNGNAFETTV
SDAHGAVGIDFGVYGVPETYVIDKAGIIRYKHTGAIDAGEMRGELLPLVRELEK
Download sequence
Identical sequences A0A086BSW5 A0A1G7UJ15 A0A1V2XRK2 A0A2E9RYW0 Q1LKQ8 Q8GQ98
266264.Rmet_2391 WP_003149830.1.100899 WP_003149830.1.11058 WP_003149830.1.11178 WP_003149830.1.1187 WP_003149830.1.12400 WP_003149830.1.12480 WP_003149830.1.12497 WP_003149830.1.13092 WP_003149830.1.14096 WP_003149830.1.15789 WP_003149830.1.19260 WP_003149830.1.22782 WP_003149830.1.23231 WP_003149830.1.24442 WP_003149830.1.25444 WP_003149830.1.25839 WP_003149830.1.29003 WP_003149830.1.30810 WP_003149830.1.31271 WP_003149830.1.34731 WP_003149830.1.35599 WP_003149830.1.37542 WP_003149830.1.38510 WP_003149830.1.40482 WP_003149830.1.42634 WP_003149830.1.43022 WP_003149830.1.43317 WP_003149830.1.445 WP_003149830.1.45298 WP_003149830.1.47314 WP_003149830.1.48990 WP_003149830.1.52578 WP_003149830.1.54239 WP_003149830.1.57841 WP_003149830.1.57966 WP_003149830.1.58417 WP_003149830.1.5850 WP_003149830.1.60396 WP_003149830.1.61294 WP_003149830.1.62035 WP_003149830.1.63423 WP_003149830.1.63697 WP_003149830.1.63989 WP_003149830.1.64825 WP_003149830.1.65247 WP_003149830.1.66286 WP_003149830.1.67948 WP_003149830.1.68800 WP_003149830.1.7038 WP_003149830.1.71570 WP_003149830.1.71738 WP_003149830.1.72772 WP_003149830.1.7448 WP_003149830.1.783 WP_003149830.1.78542 WP_003149830.1.79921 WP_003149830.1.81368 WP_003149830.1.8203 WP_003149830.1.82703 WP_003149830.1.83617 WP_003149830.1.85815 WP_003149830.1.86925 WP_003149830.1.87716 WP_003149830.1.89494 WP_003149830.1.89848 WP_003149830.1.89939 WP_003149830.1.9034 WP_003149830.1.91527 WP_003149830.1.92321 WP_003149830.1.93250 WP_003149830.1.94230 WP_003149830.1.94896 WP_003149830.1.96852 WP_003149830.1.96967 WP_003149830.1.9698 WP_003149830.1.98111 WP_003149830.1.98814 WP_003149830.1.98819 WP_003149830.1.99341 gi|94311327|ref|YP_584537.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]