SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94311450|ref|YP_584660.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94311450|ref|YP_584660.1|
Domain Number 1 Region: 87-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.53e-32
Family Glutathione S-transferase (GST), C-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 1-92
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.59e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94311450|ref|YP_584660.1|
Sequence length 214
Comment glutathione S-transferase [Cupriavidus metallidurans CH34]
Sequence
MLRIWGRLSSINVQKVVWCARELHLDHERIDIGNQKGELDTEAYVRLNPNRLIPVIEDFR
DTDVAGEPFVLWESNAIVRYLCARYGEDTLWPSDVKARASADRWMDWQTTTFSPAMVQAF
LQLVRTPADKRDEAVIEKSCERTEPLAKMLDDALEGREFIGGDRFTMADVSLACAAHRWM
GMPKAHTARPNLERWLAAMRARPAATGILELPLK
Download sequence
Identical sequences A0A132HKR5 Q1LKD5
WP_011517089.1.12480 WP_011517089.1.25839 WP_011517089.1.481 WP_011517089.1.52493 WP_011517089.1.66126 gi|94311450|ref|YP_584660.1| 266264.Rmet_2514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]