SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94311523|ref|YP_584733.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94311523|ref|YP_584733.1|
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000261
Family Glutathione S-transferase (GST), N-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94311523|ref|YP_584733.1|
Sequence length 202
Comment glutathione s-transferase protein [Cupriavidus metallidurans CH34]
Sequence
MRLIGMLDSPYVRRVAIALRLLDLPFTHESVSVFRTFDQFRAINPVVKAPSLVCDNGVVL
MDSTLIIDYAETLAGRSLMPAGLADRQHALRTIGLALAACEKVVQNVYEHNLRPEAKQHE
PWLERIDGQRAAAFELLEQEIAKMPVPADARALDQVGLTAAVVWTFTQAMLPGKVDPARH
PVLAAFTSAVERFAPFQDLPHA
Download sequence
Identical sequences Q1LK62
WP_011517167.1.12480 WP_011517167.1.25839 gi|94311523|ref|YP_584733.1| 266264.Rmet_2587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]