SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94311999|ref|YP_585209.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94311999|ref|YP_585209.1|
Domain Number 1 Region: 1-163
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.04e-44
Family Glutathione peroxidase-like 0.00000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94311999|ref|YP_585209.1|
Sequence length 166
Comment lipid hydroperoxide peroxidase [Cupriavidus metallidurans CH34]
Sequence
MSNVTLGGNAIEVGGKFPHSGDKAPAFSLVGKDLKDVSLADFAGKRKVLNIVPSLDTPVC
QASARKFNEAAGNLNNTVVLTISADLPFAMGRFCTTEGLANVVTLSTMRGAEFKNAYGVD
IKTGPLAGVCARAVVVVDENDTVKYSELVSEIKQEPNYDAALAALK
Download sequence
Identical sequences A0A132HEC5 Q1LIT6
266264.Rmet_3068 WP_011517568.1.12480 WP_011517568.1.22474 WP_011517568.1.25839 WP_011517568.1.38154 WP_011517568.1.481 WP_011517568.1.52493 WP_011517568.1.66126 gi|94311999|ref|YP_585209.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]