SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94312121|ref|YP_585331.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94312121|ref|YP_585331.1|
Domain Number 1 Region: 105-248
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.16e-35
Family DsbC/DsbG C-terminal domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 45-97
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.00000000000451
Family DsbC/DsbG N-terminal domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94312121|ref|YP_585331.1|
Sequence length 252
Comment Protein-disulfide isomerase [Cupriavidus metallidurans CH34]
Sequence
MFQMFRRRSARFAAIAALASGVGAAGYALHALAADEPGTDRIKASIQKILGGRAEVKSVT
KAPVPGLYEVNVSGQLVYTDATGRYIINGELIDTKTNTNLTEERLAELNKIKWSDLPLSR
AIKWTKGDGSRTVAVFSDPNCGYCKKIEQTFQQMDNITVYTFLYPVLSPDSTVKAKQVWC
SADRTKVWRDWMLNHVALTGNGSCKTPVDENLELGHNLNITGTPAVFFSDGTRIPGAADA
ATLERKLASLKK
Download sequence
Identical sequences Q1LIG4
WP_011517671.1.12480 WP_011517671.1.25839 WP_011517671.1.52493 gi|94312121|ref|YP_585331.1| 266264.Rmet_3190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]