SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94312219|ref|YP_585429.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94312219|ref|YP_585429.1|
Domain Number 1 Region: 25-143
Classification Level Classification E-value
Superfamily Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 5.23e-35
Family Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.00014
Further Details:      
 
Domain Number 2 Region: 513-615
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.1e-22
Family Thioltransferase 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94312219|ref|YP_585429.1|
Sequence length 624
Comment Thiol:disulfide interchange protein (Protein-disulfide reductase) [Cupriavidus metallidurans CH34]
Sequence
MRHIAALWLTVFACLFFWNVAHAATEDDFLPPEQAFRFAARQVDQKTVEVRFDVADGYYL
YRERFSFAAQPADVKLGKPEMPAGKVHFDETFGKDMETYRGAVVIKVPVEQAPADGRWSL
VVTSQGCADKGLCYPPMESVYKVGGSALGNLFGDRGAAAQSTPEAQAPAAVQPAPDRAAP
TRPSKVVDDTDRIANALASRNLALIGALFFGLGILLTFTPCVLPMVPILSSIVVGEHVTR
GRAFLVSLSYVLGMAVVYTTVGVAAGLAGEGLAAALQTPWVLGAFAALMVALAMSMFGMY
ELQMPQRWQARLTESSNRRQSGQFVGAALMGAISALIVGPCVTAPLAGALAYIAQTGDAI
TGGAALMAMALGMGVPLMLVGMGAGNLLPRAGKWMEATKRFFGFLLLGVAIWMVTPVLPA
WVVMLAWAALLLVAAVYLGAFDALGPDPRGVMRLGKGLGLLAALVGAIQIVGVASGGRNP
LQPLSHLSLSAATLPPHAAEIRFERVRNIAELDARIAQASAAGRPVLLDFYADWCVSCKE
MEKLTFPDAKVRAQLADVVLLQADVTANNADDRALLKRFGLFGPPGIILFGKDGQERPVR
VIGYQSASRFLESLERALGPRSQT
Download sequence
Identical sequences Q1LI66
gi|94312219|ref|YP_585429.1| 266264.Rmet_3288 WP_011517761.1.12480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]