SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94312367|ref|YP_585577.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94312367|ref|YP_585577.1|
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.46e-31
Family ArsC-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94312367|ref|YP_585577.1|
Sequence length 119
Comment putative oxidoreductase [Cupriavidus metallidurans CH34]
Sequence
MITIYHNPRCSKSRETLALVESAAQRLGEPVEIVEYLKTPPSLATLRQLHTMLGVPVRAM
IRDGESAYKELDLADPGLTDAELLAAVADNPILLQRPVVVRNRRAAIGRPPENVAQLLG
Download sequence
Identical sequences A0A132HAD1 Q1LHR8
WP_011517868.1.12480 WP_011517868.1.25839 WP_011517868.1.481 WP_011517868.1.52493 WP_011517868.1.66126 266264.Rmet_3436 gi|94312367|ref|YP_585577.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]