SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94313851|ref|YP_587060.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94313851|ref|YP_587060.1|
Domain Number 1 Region: 103-232
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.85e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.0027
Further Details:      
 
Domain Number 2 Region: 11-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.42e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94313851|ref|YP_587060.1|
Sequence length 235
Comment glutathione S-transferase [Cupriavidus metallidurans CH34]
Sequence
MADLSAFPITKRWPAQHPDRLQLYSLNTPNGIKVSLMLEETGLPYEPHLVRFDKNDQMTP
EFLSLNPNNKIPAILDPNGPGGKPLALWESGAILLYLAEKTGKFMSADPALRYETIQWVM
FQMGGIGPMFGQVGFFNRFAGKDFEDKRPRDRYVSESRRLLNVLNERLKGRQWIMGDDYT
IADMATFPWIRNLLGFYEAGDLVGIQDFPEVTRVLGAFVARPAVQRAVNIPKRPE
Download sequence
Identical sequences Q1LDI5
gi|94313851|ref|YP_587060.1|NC_007974 gi|94313851|ref|YP_587060.1| WP_011519351.1.12480 WP_011519351.1.25839 266264.Rmet_4929 3694.eugene3.28270001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]