SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94314610|ref|YP_587819.1| from Cupriavidus metallidurans CH34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94314610|ref|YP_587819.1|
Domain Number 1 Region: 52-150
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000139
Family Thioltransferase 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94314610|ref|YP_587819.1|
Sequence length 257
Comment Thioredoxin-(TRX) like protein [Cupriavidus metallidurans CH34]
Sequence
MTTHSTGTREQWLAARLALLKAEKELTRRSDELARQRQALPWVRVDKAYRFDTEQGSASL
ADLFWGRSQLLVYHFMFGPDYKAGCPSCSSIADSFNGIAIHLANHDVMLWAASRAPLDKL
LAYRRRMGWTFPWASSSSSDFNFDFNVSMTEAQQRAGDAEYNYERGRRKLDTAQPPEPLK
TFAATCGTDAATFSRDLPGLSAFVIEDNVIYHTYSTYARGLDGLWGMYQWLDRAPRGRNE
AGPWWKRHDEYADPAPA
Download sequence
Identical sequences Q1LBC6
WP_011520092.1.12480 WP_011520092.1.25839 gi|94314610|ref|YP_587819.1|NC_007974 gi|94314610|ref|YP_587819.1| 266264.Rmet_5691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]