SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_00261 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_00261
Domain Number 1 Region: 73-292
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.97e-46
Family Ankyrin repeat 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_00261
Sequence length 764
Comment | SCRG_00261 | Saccharomyces cerevisiae RM11-1a ankyrin repeat-containing protein (765 aa)
Sequence
MVNELENVPRASTLTNEEQTVDPSNNDSQEDISLGDSNEITSLASLKAIRSGNEEESGNE
QVNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINN
RLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLL
HLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASI
KIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREAL
THSGFDYHGYPIKKWFKKSQHAKLVTFITPFLFLGIAFALFSHINPLFVIIVLFLLAIAT
NKGLNKFVLPSYGRMGVHNVTLLRSPLLSGVFFGTLLWVTIVWFFKVMPRTFSDEQYTNI
LMLVILVSVFYLFGQLVIMDPGCLPEETDHENVRQTISNLLEIGKFDTKNFCIETWIRKP
LRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITLMESGIFTFLALCLEYFDEL
EDAHEDTSQKNGKCFILGASDLCSGLIYDRFVFLILLWALFQSIWVASLIFVQAFQICKG
MTNTEFNVLMKESKSIGPDGLSFNENFNTTPEGFAPSIDPGEESNDTVLAPVPGSTIRKP
RTCFGVCYAVTGMDQWLAVIKETIGIKDSTGHNVYSITSRIPTNYGWKRNVKDFWLTSDI
NAPLWRRILYPPSGSKALLNGIEVDYFKLYKLPNKDVEQGNDMV
Download sequence
Identical sequences B3LG26
YDR264C SCRT_00261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]