SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_00465 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_00465
Domain Number 1 Region: 468-511
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000195
Family Ankyrin repeat 0.0055
Further Details:      
 
Weak hits

Sequence:  SCRT_00465
Domain Number - Region: 65-102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000101
Family HkH motif-containing C2H2 finger 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_00465
Sequence length 632
Comment | SCRG_00465 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (633 aa)
Sequence
MNSQKASKMTGSLKKNDLYIFDLSEQLLNSLKLMSFDSTLREVEVEKTSDNDRNKESGDL
QIARKKVTSNVMRCSVCQMSFDSRNEQKAHYQTDYHLMNVKRNLRGLDILSVEEFDALIS
KEHGIKSEDENSDGEQTSSDHEESEEASDRDPDLQTNNYMETIIENDLQKLGFQKDESDA
ISHINTQSPYIYFKSKYLQKNEVLAIYKSLFNKRSLSNPNEALTFWNSQENPMAISALFM
VGGGHFAGAIVSHQRLNVKGNAHKKDETLIEQAVNFLEHKTFHRYTTRRKQGGSQSAMDN
AKGKANSAGSALRRYNESALKTDIQGVLKDWEPYLSKCDNIFIRARNVSDKKIFTDNTVL
NKGDERIKSFPFTTNRPTVLELKKAWCELSYLKILPKPEPLAVKETVQKLEVSNKKDEFK
EKQEPLLEEIQTEEIISLLKKGRAPLLISFLKKNKLDGNFRLKPESKYSLTPTMLHYASQ
QGMKQMALILLSNIKCDPTIKNRLGRTAWDLNRNDDVRHAFQIARYNLGESFTNWDETHI
GQPLSREQVDEINEKKKAIENEKAEKLIKLELVAAKEKQRFAKDAERGPGKKLTNIPSIE
QQNLNSLTDEQRRRLMREQRARAAEERMKKKY
Download sequence
Identical sequences A0A0L8VTE0 B3LGL9
YDR049W YDR049W YDR049W SCRT_00465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]