SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_00524 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_00524
Domain Number 1 Region: 891-1283
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.88e-124
Family Oxysterol-binding protein 0.0002
Further Details:      
 
Domain Number 2 Region: 288-387
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-17
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 30-248
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.74e-17
Family Ankyrin repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_00524
Sequence length 1283
Comment | SCRG_00524 | Saccharomyces cerevisiae RM11-1a hypothetical protein similar to SWH1 (1284 aa)
Sequence
MSREDLSIAEDLNQVSKPLLKVKLLEVLGQGDFKHLKALVDNEFQPKDDPSVQQVLNLIL
HYAVQVAPILLIKEIVAHWVDQVGDEKSSSKSDDGIHLDLNYQDENGNTPLHLAAAQSRS
DVISFLLSQKSINDCVKNKAHQQPLDMCKDLNVAQMIQLKRDDYFLETVHSLRAAMNKRD
FSKLDSIWKNPRNLNLLDINGIDPETGTTLLYEYSQKKDIEMCQWLLKHGAEATVKDGKG
RSPLDLVKNIKLPAKPSNNVTPEIKLKNLLEKNLREQAIVHEDVASSKPPTYKGFLKKWT
NFAHGYKLRWFILSGDGNLSYYKDQSHVDRPRGTLKVSTCRLHIDSSEKLNFELLGGITG
TTRWRLKGNHPIETTRWVNAIQSAIRFAKDKEILNKKKAVPPSLALKNKSPALISHSKTH
GSLPEASQYYQHTLHKEVIQPSSVSLYRRPSNNLSVVSSEIQLNDNLTESGKRFVSKMIE
NRLDGSKTPVGVHTGSALQRVRSSNTLKSNRSMQSGSGVASPIDKVPNGANLSQSNTTTG
STASLSDNNYIDNFEGDEANSDDEEEDLGINFDRDEEYIKAQYGPYKEKLDMYEQAISIE
LSSLIELIEQEEPSPEVWLTIKKSLINTSTIFGKLKDLTYKRDKRLVDMVSKQGDVNNVW
VQSVKELEMELSNKTERLASIDKERRGLKKILHKKLLESHATAGNKESLENDKEQESDTT
ASTLGQIAKFISATKEEDEASDADEFYDAAELVDEVTELTEAHPEISTAAAPKHAPPPVP
NETDNDSQYVQDEKSKIESNVEKTSQKFEKQNNLVTEDEPKTDQSLKNFKAEDKESQVKE
KTKEIASSVIDEKTIVAVTTVQKRKEEYLLKEGSYLGYEDGIRKRLSMDKDDRPKISLWA
VLKSMVGKDMTRMTLPVTFNEPTSLLQRVAEDLEYSELLDQAATFEDSTLRTLYVAAFTA
SSYASTTKRVAKPFNPLLGETFEYSRPDKQYRFFTEQVSHHPPISATWTESPRWDFWGES
FVDTKFNGRSFNVKHLGLWHIKLRPNDNEKEELYTWKKPNNTVIGILIGNPQVDNHGEVN
VVNHTTGDHCKLYFKARGWRSSGAYEITGEVYNKKKQKVWILGGHWNEAIFAKKVVKDGD
LSLEKTRTAASAGNGPTDDGTKFLIWKANDRPEEPFNLTPFAITLNAPQPHLLPWLPPTD
TRLRPDQRAMEDGRYDEAGDEKFRVEEKQRAARRKREENNLEYHPQWFVRDTHPITKAKY
WRYTGKYWVKRRDHDLKDCGDIF
Download sequence
Identical sequences B3LGS4
YDL019C SCRT_00524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]