SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_00791 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_00791
Domain Number 1 Region: 415-646
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.96e-37
Family Ankyrin repeat 0.001
Further Details:      
 
Weak hits

Sequence:  SCRT_00791
Domain Number - Region: 931-1066,1106-1145
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 0.0649
Family Glycerophosphoryl diester phosphodiesterase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_00791
Sequence length 1177
Comment | SCRG_00791 | Saccharomyces cerevisiae RM11-1a phosphate system positive regulatory protein PHO81 (1178 aa)
Sequence
MKFGKYLEARQLELAEYNSHFIDYKALKKLIKQLAIPTLKASSDMDLHLTLDDIDEKIIH
QRLQENKAAFFFKLERELEKVNGYYLARESDLRIKFNILHSKYKDYKINGKLNSNQATSF
KNLYAAFKKFQKDLRNLEQYVELNKTGFSKALKKWDKRSQSHDKDFYLATVVSIQPIFTR
DGPLKLNDETLHILLELNDIDNNNRRADIQSSTFTNDDDDDNNTSNNNKHNNNNNNNNNN
NNNNNNNTLHDNYELTTSKILENQLEHLFQASSSSLDMEMEIENWYKEILNIATVKDVQR
KHALLRNFRETKIFTYLLQNSSESFHKNVFSLLKECLTTLFLLLVASPLDDNSLHIFYKS
NQDHIDLSYCDEDDQVFSRKNVFHEAASCPEKSRLFILDEALTTSKLSKETVQKLLNAQD
IHSRVPLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTI
GGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNK
SSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVR
SGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNLPSAPLNEINS
QSSTQRLNTIDLTPNNDKFDLDIQDSIPDFALPPPIIPLRKYGHNFLEKKIFIKLKLRPG
LESIKLTQDNGIIMSSSPGRITLSSNLPEIIPRNVILPVRSGEINNFCKDISETNDEEDD
DEISEDHDDGEIIFQVNSIDDFSMDFEIFPSFGTRIIAKTTAMPFLFKKVAINSIATVKL
PLFDTRLNNIGSLTLDYQIIFPYPGNPLKIIKYEPYWKSTGSDLMTSSKDGNFVTSSSLN
GSFISVLVCALNDETIVAAPKPYVEFKGTKILLNDLTKEQLEKVVDYDFGKIDGSFDEVT
LKQYLSSRVVPLRRLLEVIPGSVQLVIGVYFPTDKEIDTIPIKISPFININQFIDKLLLI
IFEHERFLRHSGSGNMRQIVFSSCNWEACSILNWKQPNFPVLLQMKSLLRDSTTGKFVGD
TPNCLKELAVNPQKMSYLNTELINIHTMVQFAMNNNLLGVTLPYEVLKICPSLARIIKQN
GLLLIASVGENDQIPADGGYSGIYYACELLFENNIGM
Download sequence
Identical sequences B3LI07
SCRT_00791 YGR233C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]