SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_00792 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_00792
Domain Number 1 Region: 5-227
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.91e-67
Family Ankyrin repeat 0.000000000823
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_00792
Sequence length 229
Comment | SCRG_00792 | Saccharomyces cerevisiae RM11-1a 26S proteasome interacting protein (230 aa)
Sequence
MSNNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKM
ENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKW
FEVSQFLIENGASVGIKDKFNQIPLHRAASVGSLKLIELLCGLGKSPVNWQDKQGWTPLF
HALAEGPGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV
Download sequence
Identical sequences B3LI08
SCRT_00792 YGR232W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]