SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_00946 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_00946
Domain Number 1 Region: 445-672
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-45
Family DBL homology domain (DH-domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 684-759
Classification Level Classification E-value
Superfamily PH domain-like 0.00000812
Family Pleckstrin-homology domain (PH domain) 0.049
Further Details:      
 
Domain Number 3 Region: 274-340
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000043
Family DEP domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_00946
Sequence length 1155
Comment | SCRG_00946 | Saccharomyces cerevisiae RM11-1a RHO1 GDP-GTP exchange protein 1 (1156 aa)
Sequence
MNSNELDLRNKYFYEIFGKKRKSDTSTPTQLFSGSKVQTNINEISITNDEDEDSTEDENK
ASLKDYTLGHDTGARYRIAPDCSSHQLKASPVLHISTNLNSSPQSFTGDQISPTNKKISI
NDSTRQDKGNSCTTTSSPSQKRSNVLLPHVRKHSSPSLLSFSKNSGSHMGDPNQLSTPPT
PKSAGHTMELHSSFNGKHSSSSTSSLFALESLKTQNRRSSNSSNHSSQYRRHTNQHQRHH
SRSKSSPVSLTEISMIKGTPLVYPALLSLIAIKFKQTIKLSTHKKMGLLYRDSFTGKQAI
DTLCLIIGSLDRNLGMLIGKSLEAQKLFHDVLYDHGVRDSVLEIYELSSESIFMAHQSQS
STSIANTFSSSSSSVNSLRTKTEIDGVFVPLTHCYSSTCSLEKLCYSISCPNRLQQQANL
HLKLGGGLKRNISLALDKEDDERISWTNSVPKSVWESLSKQQIKRQEAIYELFTTEKKFV
KSLEIIRDTFMKKLLETNIIPSDVRINFVKHVFAHINEIYSVNREFLKALAQRQSLSPIC
PGIADIFLQYLPFFDPFLSYIASRPYAKYLIETQRSVNPNFARFDDEVSNSSLRHGIDSF
LSQGVSRPGRYSLLVREIIHFSDPVTDKDDLQMLMKVQDLLKDLMKRIDRASGAAQDRYD
VKVLKQKILFKNEYVNLGLNNEKRKIKHEGLLSRKDVNKTDASFLGDIQFYLLDNMLLFL
KSKAVNKWHQHTVFQRPIPLPLLFICPAEDMPPIKRYVTENPNCSAGVLLPQYQTSNPKN
AIVFAYYGTKQQYQVTLYAPQPAGLQTLIEKVKQEQKRLLDETKHITFKQMVGQFFHSYI
NTNRVNDVLICHAGKILLVATNMGLFVLNYATSINQKPVHLLHKISISQISVLEEYKVMI
LLIDKKLYGCPLDVIDDAENADFLFRKNSKVLFKYVAMFKDGFCNGKRIIMIAHHFLHTV
QLLIVNPLIFDFNSGNFKKNLKAGLVDFSVDSEPLSFSFLENKICIGCKKNIKILNVPEV
CDKNGFKMRELLNLHDNKVLANMYKETFKVVSMFPIKNSTFACFPELCFFLNKQGKREET
KGCFHWEGEPEQFACSYPYIVAINSNFIEIRHIENGELVRCVLGNKIRMLKSYAKKILYC
YEDPQGFEIIELLNF
Download sequence
Identical sequences B3LIF5
SCRT_00946 YGR070W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]