SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_01226 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_01226
Domain Number 1 Region: 12-147
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-16
Family Ankyrin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_01226
Sequence length 181
Comment | SCRG_01226 | Saccharomyces cerevisiae RM11-1a hypothetical protein similar to HRE181 gene (182 aa)
Sequence
MNTEGASLSEQLLDAARRNNLDLLETVFDSLDNDPEKIAKLINESKEPLGNTALHLCCKY
GSWEVFDRILDQDGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV
RNYNNQKPVDLVHGDELDELIDLLQGAELAIDSTNGSGDNNEDGEMIDDGPSDDDEEDDK
K
Download sequence
Identical sequences A0A0L8VQY9 A6ZTU9 B3LHT4 B5VIA1 C7GNY8 C8Z815 E7LU50 E7QEE9
SCRT_01226 YGL242C tr|A6ZTU9|A6ZTU9_YEAS7 YGL242C YGL242C YGL242C YGL242C YGL242C YGL242C YGL242C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]