SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_01258 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_01258
Domain Number 1 Region: 22-227
Classification Level Classification E-value
Superfamily PH domain-like 4.34e-76
Family Dcp1 0.00000000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_01258
Sequence length 231
Comment | SCRG_01258 | Saccharomyces cerevisiae RM11-1a hypothetical protein similar to subunit of the Dcp1p-Dcp2p decapping enzyme complex (232 aa)
Sequence
MTGAATAAENSATQLEFYRKALNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLE
YQGVLAIYLRDVSQNTNLLPVSPQEVDIFDSQNGSNNIQVNNGSDNSNRNSSGNGNSYKS
NDSLTYNCGKTLSGKDIYNYGLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLE
CMGVEVKDELVIIKNLKHEVYGIWIHTVSDRQNIYELIKYLLENEPKDSFA
Download sequence
Identical sequences A0A250WBY4 A6ZN63 B3LIR8 B5VRB2 C8ZHG8 E7KHX0 E7KU13 E7LZW3 E7NMJ1 E7Q8Y7 G2WM89 H0GMY9 N1NY49 Q12517
CX00009 Pf-sce:YOL149W YOL149W YOL149W YOL149W YOL149W SCRT_01258 YOL149W NP_014492.1.97178 YOL149W YOL149W YOL149W tr|A6ZN63|A6ZN63_YEAS7 YOL149W 1q67_A 1q67_B YOL149W YOL149W YOL149W YOL149W YOL149W YOL149W YOL149W 4932.YOL149W YOL149W 1q67A YOL149W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]