SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_01436 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_01436
Domain Number 1 Region: 50-271
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.26e-45
Family Ankyrin repeat 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_01436
Sequence length 746
Comment | SCRG_01436 | Saccharomyces cerevisiae RM11-1a hypothetical protein similar to AKR2 (747 aa)
Sequence
MSIIDDENVKKTSNGAAVVTDVAQHAVSDSDNNKAQLLGDGSNTEYVVDIFIEAAKDGDL
KVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALH
WAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDI
DSKDNNNRTPLLWAAYQGDFLTVELLLKFGATVTWTDNRGFNALHCALVGGDQRVICDLI
LSGANFYERNNQKQDCFDLAEGMGTKSLFEQALQHHGYDRLGNQKDKLFKKSSHAQFTIF
LSPFLLMVYIYLISLVLSPVLAIMLSLLVTVVMVNTLKKFVLPCLPRKNTYKVSLTRTPF
FSGLFLSTFCFLIYIWTKKLYPYSVSDYTMKNVQFLVTSFLTVVLFLRLVRSDPGCLKTD
DSLTSIQETIKQLIDLGKFDRENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDV
GLKNHKLFVFFAVTVQYHMFLFMWLCLAYFKKTNYIYEQVEEYARCALLKNETLCKGSNY
DPSTFFLFIWISVNFIWLGAMLIVQFFQILKGITTPELFILIKEERKAKFINLIPFENST
YTSKSKGVEDSDMVPEGPSATTITHTISIDGLEPRNRRRAILSACFSMMGINQWLVTIKE
IVGITHILHGQVPQQHHSSLLRSFLVTNHWKTNLTDFWLNSDVTAPLWQRFFYSSDTSKA
MLGGTEVDYYELYEYPAREGEVLRPN
Download sequence
Identical sequences B3LJ87
SCRT_01436 YOR034C YOR034C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]