SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_01573 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_01573
Domain Number 1 Region: 13-127
Classification Level Classification E-value
Superfamily PH domain-like 8.08e-32
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_01573
Sequence length 633
Comment | SCRG_01573 | Saccharomyces cerevisiae RM11-1a actin assembly factor (634 aa)
Sequence
MGLLNSSDKEIIKRALPKASNKIIDVTVARLYIAYPDKNEWQYTGLSGALALVDDLVGNT
FFLKLVDINGHRGVIWDQELYVNFEYYQDRTFFHTFEMEECFAGLLFVDINEASHFLKRV
QKRERYANRKTLLNKNAVALTKKVREEQKSQVVHGPRGESLIDNQRKRYNYEDVDTIPTT
KHKAPPPPPPTAETFDSDQTSSFSDINSTTASAPTTPAPALPPASPEVRKEETHPKHSLP
PLPNQFAPLPDPPQHNSPPQNNAPSQPQSNPFPFPIPEIPSTQSATNPFPFPVPQQQFNQ
APSMGIPQQNRPLPQLPNRNNRPVPPPPPMRTTTEGSGVRLPAPPPPPRRGPAPPPPPHR
HVTSNTLNSAGGNSLLPQATGRRGPAPPPPPRASRPTPNVTMQQNPQQYNNSNRPFGYQT
NSNMSSPPPPPVTTFNTLTPQMTAATGQPTVPLPQNTQAPSQATNVPVAPPPPPAFLGQS
QIPQSAPSAPIPPTLPSTTSAAPPPPPAFLTQQPQSGGAPAPPPPPQMPATSTSGGGSFA
ETTGDAGRDALLASIRGAGGIGALRKVDKSQLDKPSVLLQEARGESASPPAAAGNGGTAG
GPPASLADALAAALNKRKTKVGAHDDMDNGDDW
Download sequence
Identical sequences A0A0L8VHG3 B3LJL2
SCRT_01573 YOR181W YOR181W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]