SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_01596 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_01596
Domain Number 1 Region: 394-431,465-630,660-742
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.94e-57
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_01596
Sequence length 750
Comment | SCRG_01596 | Saccharomyces cerevisiae RM11-1a tyrosine phosphatase (751 aa)
Sequence
MDRIAQQYGSGKRDNNGNRMASSAISEKGHIQVNQTRTPGQMPVYRGETINLSNLPQNQI
KPCKDLDDVNIRRNNSNRHSKILLLDLCAGPNTNSFLGNTNAKDITVLSLPLPSTLVKRS
NYPFENLLKNYLGSDEKYIEFTKIIKDYDIFIFSDSFSRISSCLKTTFCLIEKFKKFICH
FFPSPYLKFFLLEGSLNDSKAPSLGKNKKNCILPKLDLNLNVNLTSRSTLNLRINIPPPN
DSNKIFLQSLKKDLIHYSPNSLQKFFQFNMPADLAPNDTILPNWLKFCSVKENEKVILKK
LFNNFETLENFEMQRLEKCLKFKKKPLHQKQLSQKQRGPQSTDDSKLYSLTSLQRQYKSS
LKSNIQKNQKLKLIIPKNNTSSSPSPLSSDDTIMTPINDYELTEGIQSFTKNRYSNILPY
EHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINP
DFKYIATQAPLPSTMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYWNNLSYSNHTIKL
QNTWENICNINGCVLRVFQVKKTAPQNDNISQDCDLPHNGDLTSTTMAVSEPFIVYQLQY
KNWLDSCGVDMNDIIKLHKVKNSLLFNPQSFITSLEKDVCKPDLIDDNNNDLHLDTANSS
PLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISM
VQNLTQYIACYEALLNYFALQKQIKNALPC
Download sequence
Identical sequences B3LJN3 C7GWH4 C8ZGW4 E7KUP2 E7M0J3 E7QKV5
YOR208W YOR208W SCRT_01596 YOR208W YOR208W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]