SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_01960 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_01960
Domain Number 1 Region: 9-193
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.48e-36
Family SCOPe 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_01960
Sequence length 426
Comment | SCRG_01960 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (427 aa)
Sequence
MLKEPSVRLREAIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLI
QLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMND
YYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWK
PIDVAQTFEVGNIYSKVLKEVKKKGPPLGAGKKPSSFRTPILNAKATFEDGPSPVLSMNS
PYSLYSNNSPLPVLPRRISTHTTSGNGGNRRSSITNPVFNPRKPTLSTDSFSSSSNSSSR
LRVNSINVKTPVGVSPKKELVSESVRHSATPTSPHNNIALINRYLLPNKSNDNVRGDSQT
ATINDDGGGGNGGDATIGMGLRKDPDDENENKYKIKVNNGEPRRRVSLLNIPISKLRNSN
NTRAED
Download sequence
Identical sequences A0A0L8VK41 B3LLW1 C7GL56 E7QJ71 H0GKZ1 N1P087 Q04749
YMR068W YMR068W YMR068W YMR068W YMR068W YMR068W YMR068W NP_013784.1.97178 SCRT_01960 YMR068W YMR068W YMR068W YMR068W 6emk_G 6emk_H YMR068W 4932.YMR068W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]