SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_02127 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_02127
Domain Number 1 Region: 105-300
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.28e-21
Family DBL homology domain (DH-domain) 0.0039
Further Details:      
 
Weak hits

Sequence:  SCRT_02127
Domain Number - Region: 423-612
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000115
Family BAR domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_02127
Sequence length 677
Comment | SCRG_02127 | Saccharomyces cerevisiae RM11-1a nuclear fusion protein FUS2 (678 aa)
Sequence
MFKTSYNLYDLNYPKNDSLTPIRDYKNDYFHKNDDKLPEIVRKPTRKLSKHENKLNDKKF
TNKRPASLDLHSIVESLSNKKIYSPINTEIFQNVVRLNLSPQIPNSPHEGCKFYKIVQEF
YLSEVEYYNNLLTANNVYRKALNSDPRFKNKLVKLDSSDELLLFGNIDTIASISKILVTA
IKDLLLAKQRGKMLDANEWQKIFTKNEVQQQLYSTFDISEAFEQHLLRIKSTYTSYFVSH
QKQMELFTTLRMNKNHFFNKWYEYCLKESGCIKLEDILKSPMKRLTQWIDTLETLESCYE
DILSPELGLKLSPTRRKYSLFSNKLETEVSEYKSNSMYNFSLTPSEIIQSYDEDQFTHLL
KPPDKQNKNICNASRQESNLDNSRVPSLLSGSSSYYSDVPGLEIVTNTSTASAEMINLKM
DEETEFFTLADHISKFKKVMKGLLELKKNLLKNDLSGIIDISLRRINAWKKVIECERPSG
AFFAHDNLISTMCSSYIDKLHEQKNQVTILKLTELETDVMNPLERIIAHCTTVKSKLKDL
QALKKDYMLFLQEKKANVRDIKRDLLGMHFQNLQNQMKRELPVFITLIHDTIECILLNYI
KVFLKYLEIIAGGKKYLQKDLENMSLNDSIATGQIKNLDILQCYSKSRYMTKRMVRKDWP
FPGDPSGSRVVRKLFEL
Download sequence
Identical sequences B3LMC1
SCRT_02127 YMR232W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]