SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_02258 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_02258
Domain Number 1 Region: 103-250
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.39e-29
Family Calponin-homology domain, CH-domain 0.0000737
Further Details:      
 
Domain Number 2 Region: 826-1137
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000000824
Family p120GAP domain-like 0.031
Further Details:      
 
Weak hits

Sequence:  SCRT_02258
Domain Number - Region: 1377-1492
Classification Level Classification E-value
Superfamily RGC domain-like 0.00549
Family RGC domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCRT_02258
Sequence length 1495
Comment | SCRG_02258 | Saccharomyces cerevisiae RM11-1a hypothetical protein similar to Iqg1p (1496 aa)
Sequence
MTAYSGSPSKPGNNNSYLNRYVENLGTNVTPPLRPQSSSKINSSLNIASPSHLKTKTSAS
NSSATILSKKVESSVSKLKPSLPNKLVGKYTVDLSNYSKIELRYYEFLCRVSEVKIWIEA
VIEEALPSEIELCVGDSLRNGVFLAKLTQRINPDLTTVIFPAGDKLQFKHTQNINAFFGL
VEHVGVPDSFRFELQDLYNKKNIPQVFETLHILISMINKKWPGKTPALTNVSGQISFTKE
EIAACKKAWPRIRDFKSLGTNINTAPASPEEPKEKRSGLIKDFNKFERPNIPVEEILVTP
RKNITDANCSDFSNTPSPYNEVPKMSNLDVVVEKRKFTPIEPSLLGPTPSLEYSPIKNKS
LSYYSPTISKYLTYDTEFYTRRSHAREEDLNYYQTFKYSPSHYSPMRRERMTEEQFLEKV
VQLQNICRGVNTRFNLYIQKRLLNLFEQDIVRFQACLRGNKFRVLSSMYLPIRRAKIDVP
HVEAIQSRIKGSRIRYKYDKLKFTLSRFSCTVELLQAYCRSKLLKTTVNTKLNDIEISHY
PLTKLQSYMRASYVRKKVMSLNTKLNDERESIMKFSAIIRGNVVRCSEDAILSAVHDVHK
ENISKLQSLIRGIFTRSCLASIIYSLGKENCNIIQLSACIRGNAVRHKVQSLFAPENILS
ETVHDLQGFVRGILVRYTLDLVDDIVEYNNLALFQAFSRGALVRESLDQKSSFYKRNVRS
VIMIQSWIRKSLQRSAYLELLDCPNPSLWAVKKFVHLLNGTATIEEVQNQLESCQASLDS
ENMKKERLLKSIRQQLNINGVLDKFGLLKDKDHELGISDSTIPKSKYQKYEKLFYMLQVD
PSYWKLLYLKEPEFVAKNVYMTFGTVNQRMNDRERSYFTRFVCEMLQNAINEAPSIESFL
DNRSQFWQTILQDFLRRESPEFFSIIVPVLDYLSDPVVDFESDPYKIYQEIHGFSSPQHC
SPVDDASTKNKFIDNLRCLWHAIEMVAEIYTRKVHTIPVEIRYLCTKIFCYAADKNIEEI
DSLRAISSILVNVFVSEYLVNREYYGYKDSNVQKNNQKIDILMKSLATVFEIKNFDGFLD
PLNQYANEIKPHIKDVLYNVLVDPEYEQEGDRLIYLDMVSPSPKLELLTEKVLEISGKFE
EYLNEFPEADILHDILEKNLDNSSFPRSGRVTLELDASAYRFLVSDDKMRKIYDQVKRAF
VYMMQIEDVDTNLYDLSISTILPQDEPNFANFLEQNPKIRDDPMIQKLKPLKYFTLKNVT
LKKIHELESTGTFCSSDNKLQNFLNDIANTIKNPNYAIDYVTQEIYITKETLTKISEMNH
SLDIELSRLKKHVDHTIKDFQKAKDFSPVHKSKFGNFKNAVKKVQGRERSELQGMKFKWN
TKQLYERGVLKTIRGEKLAELTVKVFGSSGPKFPDIIFKISTSDGSRFGIQMIDKRKGPD
KRYSDDVDSFSFKDLIKTQVEPKIETWKLFHSNVVVNNSQLLHLIVSFFYKRNAL
Download sequence
Identical sequences B3LKJ0
YPL242C SCRT_02258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]