SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_02261 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_02261
Domain Number 1 Region: 19-148
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.53e-21
Family Ankyrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_02261
Sequence length 199
Comment | SCRG_02261 | Saccharomyces cerevisiae RM11-1a ankyrin repeat-containing protein YAR1 (200 aa)
Sequence
MGLHSEPLDQEDQDTIILDARAGDLDSLKDIFTTLVSPKLLSTCKESESDSTALHMAAAN
GHIETVRYILETVSRANSAEDLKAFVNEVNKTGNTALHWASLNGKLDVVKLLCDEYEADP
FIRNKFGHDAIFEAENSGKEEVETYFLKKYDVEPEDDEDTQTEGKNSVQITKGTEIEQVT
KEATEALREETEKLNINKD
Download sequence
Identical sequences A6ZW17 B3LKJ3 B5VSU4 C7GU77 C8ZIE0 E7KJ79 E7KV94 E7M0X1 E7NNL3 E7QA31 E7QLK6 H0GP99
tr|A6ZW17|A6ZW17_YEAS7 YPL239W YPL239W SCRT_02261 YPL239W YPL239W YPL239W YPL239W YPL239W YPL239W YPL239W YPL239W YPL239W YPL239W YPL239W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]