SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_02381 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_02381
Domain Number 1 Region: 901-1107
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00086
Further Details:      
 
Domain Number 2 Region: 623-762
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000184
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 
Domain Number 3 Region: 543-612
Classification Level Classification E-value
Superfamily PX domain 0.0000183
Family PX domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_02381
Sequence length 1128
Comment | SCRG_02381 | Saccharomyces cerevisiae RM11-1a rho GTPase activating protein (1129 aa)
Sequence
MTDNLTTTHGGSTTLELLAQYNDHRSKKDKSIEHIEKGTCSGKERNPSYDEIFTENIKLK
LQVQEYETEIESLKKVIDMLQKNREASLEVVLEQVQNDSRDSYVNDQSFVLPPRSAERKA
HIKSLNLPIPTLSPPLQQGSDVALETSVTPTVPQIGVTSNTSISRKHLQNMILNDEIEAN
SSFSSPKIINRSVSSPTKIHSEQLASPAASVTYTTSRITIKSPNKGSKSPLQERLRSPQN
PNRMTAVINNHLHSPLKASTSNNLDELTESKSQQLTNDAIQKNDRVYSSITSSAYTTGTP
TSAAKSPSSLLEVKEGENKALGFSPASKEKLDDFTQLLDSSFGEEDLVNTDSKDPLSIKS
TINESLPPPPAPPTFFSPTSSGNIKNSTPLSSHLASPVILNKKDDNFGAQSAKNLKKPVL
TSSLPNPSTKLSTTSQNASLPSNPPVESSSKQKQLGETASIHSTNTLNTFSSTPQGSLKT
LRRPHASSVSTVKSVAQSLKSDIPLFVQPEDFGTIQIEVLSTLYRDNEDDLSILIAIIDR
KSGKEMFKFSKSIHKVRELDVYMKSHVPDLPLPTLPDRQLFQTLSPTKVDTRKNILNQYY
TSIFSVPEFPKNVGLKIAQFISTDTVMTPPMMDDNVKDGSLLLRRPKTLTGNSTWRVRYG
ILRDDVLQLFDKNQLTETIKLRQSSIELIPNLPEDRFGTRNGFLITEHKKSGLSTSTKYY
ICTETSKERELWLSAFSAYIDPSQSLSLSSSRNANDTDSASHLSAGTHHSKFGNATISAT
DTPSYVTDLTQEYNNNNNISNSSNNIGNSDGIDSNPSSHSNFLASSSGNAEEEKDSRRAK
MRSLFPFKKLTGPASAMNHIGITISNDSDSPTSPDSIIKSPSKKLMEVSSSSNSSTGPHV
STAIFGSSLETCLRLSSHKYQNVYDLPSVVYRCLEYLYKNRGIQEEGIFRLSGSSTVIKT
LQERFDKEYDVDLCRYNESIEAKDDEASPSLYIGVNTVSGLLKLYLRKLPHLLFGDEQFL
SFKRVVDENHNNPVQISLGFKELIESGLVPHANLSLMYALFELLVRINENSKFNKMNLRN
LCIVFSPTLNIPISMLQPFITDFACIFQGGEPVKEEEREKVDIHIPQV
Download sequence
Identical sequences B3LKV9
SCRT_02381 YPL115C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]