SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_02571 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_02571
Domain Number 1 Region: 125-192,238-271
Classification Level Classification E-value
Superfamily PH domain-like 0.00000603
Family Pleckstrin-homology domain (PH domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCRT_02571
Sequence length 770
Comment | SCRG_02571 | Saccharomyces cerevisiae RM11-1a conserved hypothetical protein (771 aa)
Sequence
MASLKVFLAVYLLGGITFLPLVLFTLYKIHLLYSNLKSASKKELDHDTADEIDEKTRLLA
RDIDPEFKAGKLEEQLGVKVFNKGWITVTKQYYYHSSEVAVILKNSNNNKDSDTALQEQI
LQRTDLKKKQRFFAVLRHGNLFLYKDDSQNANLVHAISLQNRFITIWPRFDELGKEELPD
ASLFTKRTCIAIFKNDLVSIDSKNHNVILPHFDPLTSAESNNGDISTNDTTHEYQSQFHS
SNQFFLYFDNNMDKEDWYYQLINASKNSNSLSTGLLDPNVSANAAHLKTKDMLQLIQDIN
STENQLTTKWLNALLGRLFLSLQQTDTLNKFIHEKICKKLNKIKTPGFLDDLVVEKVDVG
DSAPLFTSPELLELSPEGSTKIAIDVQYRGNLTIIIATKASINLGSHFKQREVSLQLSIK
IKEFSGPLLFLIKPPPSNRIWYAFRTEPIMDFEIEPIVSSSKLSYNVVTNAIKSKFAEAV
KESLVVPFMDDIVFYPTPNEVYRGGIWEEQDPEAAARARTAAAASDMNNTSAKEHLEALQ
EGGMKTQSRIKKALRPERKKENLKDLVDASGVATKTTTQTTVTTATNDDVSSSENSTKSR
KYFKNSIKKIGRWYKDNVGNSSDTEDMDEIDVQDKKNDDSADERESDNPILTSNPKMISN
RRPVPRRPSQPLNTLSPKLEGRKEKDTESFPVPPSASNMNASKMFANKENRKFSVSSNDS
QNSLKNGDPHVKASKLESSQAFVKKTSQNRFNDGFFKQDLEFEEQREPKL
Download sequence
Identical sequences B3LK58
SCRT_02571 YPR091C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]