SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SCRT_03185 from Saccharomyces cerevisiae RM11-1a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SCRT_03185
Domain Number 1 Region: 444-554
Classification Level Classification E-value
Superfamily PH domain-like 4.76e-18
Family Pleckstrin-homology domain (PH domain) 0.053
Further Details:      
 
Domain Number 2 Region: 236-425
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000398
Family BAR domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCRT_03185
Sequence length 656
Comment | SCRG_03184 | Saccharomyces cerevisiae RM11-1a hypothetical protein similar to phosphoinositide PI4,5P(2) binding protein (657 aa)
Sequence
MSYQRNSARASLDLRSQYQQLEGRMRSEHFNPAYQQQQQKGQNMPLSLPSSLAQRNPIPY
PIDAVTSDPTIPAQLNVYDHDRQNSIVDAAAGTNTTHSLNSNNIPSSQNNNINNNNINNV
GSFTDPSMLTLPKMSLHSHQKQYDSNQNDPRSPLAILIPTSAQPTDVLSARFSAWRNVIR
AILVYLSETASIQDEIVRQQLRLSHAVQFPFFSIENQYQPVSNEDKSMQKFFLPLGSGSV
QDLPTMLTKYHDNLASLASKSSKELTSEIIPRLEDLRRDLLVKIKEIKALQSDFKNSCNK
ELQQTKHLMKLFNESLKECKLGTPKSDPFLIKLQLEKQIKRQLVEENYLHEAFDNLQNSG
AQLESVIVMEIQNGLTSYARILGKEAQVVFDSVISKLDSTILNKNTNLEWDSFILRNISN
FVPPNLPMRRFKEISYSNQNDPFTFEVKSGFLEKRSKFLKSYSRGFYVLTPSFLHEFKTP
DKHKFSTPLMSIPLVECTVTEHSKKTKSNSEQGKNKFILRTNSNGLIHRGHNWVFKVDSY
DDMIEWFGNIKALSSLPNYDDKCKFVSKVAKLSKEKAKSNENTTESVTPQVTNEQHTRYD
DVSSSNFPLNSIPKLDNLTITNTTSSIPETNDSQIQNRVPEFYIENVDSPRKSNQL
Download sequence
Identical sequences A0A0L8VIQ3 B3LNQ9 C8ZGI1 E7QJT2 H0GMN9
YNL047C SCRT_03185 YNL047C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]